PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001236-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 451aa    MW: 50204.6 Da    PI: 5.2102
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001236-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.14.1e-091659340
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                   +r C+ + +k+++++C  ++ +lC+ C ++ H+       H++v
  NNU_001236-RA 16 ARACDSCLRKRARWYCAADDAFLCQGCDSSVHSAnplarrHERV 59
                   578*****************************667888888876 PP

2CCT68.12.4e-23397440144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  NNU_001236-RA 397 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 440
                    9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8931461IPR000315B-box-type zinc finger
SMARTSM003365.7E-111461IPR000315B-box-type zinc finger
PfamPF006431.2E-71659IPR000315B-box-type zinc finger
CDDcd000211.42E-91761No hitNo description
PROSITE profilePS5101716.083397439IPR010402CCT domain
PfamPF062036.1E-18397439IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MSSDKKAANA VGGKTARACD SCLRKRARWY CAADDAFLCQ GCDSSVHSAN PLARRHERVR  60
LKTASIKPML NDGFLVENSA PAWHQGFTRK ARTPRHVKPA ALQPPKVEEP ILLNPLPLVP  120
EMGGEESSPD DNEEQLLYRV PIFDPFVAEL CTPATFNEPA MTTNDATTAE DMGSERKALL  180
PDGHDFDNDL TGETDKLPVF LLSDMDIAEF AADVETLLGR GLDDDSFGME DLGLLDCKEE  240
ENMEHCFRSG RVKVEVEEVE AVVGCQQVEP GLGMTRESLD LNFNSDSPTT AEEEEVEEKA  300
VKEAANSNVV TNMNSGYKGD KMSSKISLRL RLNYEGVICA WASKGSPWTT GERPQFNPDD  360
DCWPDCMGTY PMEVYHHHPY GEMGGVGGHV TMGNGGREAR VSRYREKRRT RLFSKKIRYE  420
VRKLNAEKRP RMKGRFVKRT SLMGVAAPFP F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1407423RRTRLFSKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263709.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLD7T9490.0D7T949_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03520.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-88B-box type zinc finger protein with CCT domain